PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016997.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 63aa    MW: 6881.75 Da    PI: 4.7224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016997.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS35.81.1e-11136339374
         GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +ll  ++ +gyrvee++g+l+lgW++rpL+++S W+
  Pbr016997.1   1 MLLTLFSAEGYRVEENQGCLTLGWHNRPLIAASGWQ 36 
                  6999*******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035143.7E-9136IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MLLTLFSAEG YRVEENQGCL TLGWHNRPLI AASGWQVMSM PEATTNQEAV GIINQNNNPN  60
HI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0078873e-70DQ007887.1 Malus x domestica DELLA protein (L3a) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008337344.14e-31PREDICTED: DELLA protein GAI-like
SwissprotQ8S4W79e-14GAI1_VITVI; DELLA protein GAI1
TrEMBLH2EIJ02e-30H2EIJ0_MALDO; Spur-type DELLA protein
TrEMBLQ0HA692e-30Q0HA69_MALDO; DELLA protein (Fragment)
STRINGGLYMA06G23940.12e-16(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-13GRAS family protein